PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009624879.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 506aa    MW: 55500.8 Da    PI: 6.6549
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009624879.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY78.67.1e-25197253259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK+vk  + +rsYYrCt+++C++kk +e+s++ ++v+ei+Y+++Hnh+
  XP_009624879.1 197 RDGYNWRKYGQKQVKIPQGSRSYYRCTHSECCAKK-IECSDHTNRVMEIIYRSQHNHD 253
                     7********************************98.*********************7 PP

2WRKY98.93.3e-31368425259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++er+ + +++++itY+g H+h+
  XP_009624879.1 368 SDGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIERAIDSTSALIITYKGVHDHD 425
                     7********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-21193255IPR003657WRKY domain
SuperFamilySSF1182904.05E-19194255IPR003657WRKY domain
SMARTSM007742.6E-23196254IPR003657WRKY domain
PfamPF031062.4E-17198253IPR003657WRKY domain
PROSITE profilePS5081118.177198255IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.5E-32352427IPR003657WRKY domain
SuperFamilySSF1182901.96E-27361427IPR003657WRKY domain
PROSITE profilePS5081132.248362427IPR003657WRKY domain
SMARTSM007743.1E-36367426IPR003657WRKY domain
PfamPF031061.9E-24369424IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MDEENESSKA AGAENSNPEE NKNDNSSVHD GGVLDGGGDE RKESGIESLH EPKVEISVSE  60
TLAHPTVHSS VQQIESDVQS KFDTDSSSSH QLSEVPVEYA LPPFEPAKEI KDKISVTRPE  120
TLSAQVQTEH QQRMPDEASS LELSPTSVTP SISSVPSPTL AERQLSAVVN GSTEEVAKQS  180
SDAKVLPVVP VLKTPSRDGY NWRKYGQKQV KIPQGSRSYY RCTHSECCAK KIECSDHTNR  240
VMEIIYRSQH NHDPPPRVNC SKESKPVVLP APANDNRMIA CPNRSFNETV PSSLKENLQE  300
TSPIAEKANQ DSCGSDTDTE ITIKEEHSDE PEQKKRLKKS DASSESVSRP GKKPKLVVHA  360
ACDVGISSDG YRWRKYGQKM VKGNPHPRNY YRCTSAGCPV RKHIERAIDS TSALIITYKG  420
VHDHDMPVPK KRQSPPSAPL IAAAAPASFT NLQAKKPELL QHQKSTTQWS VDKEGALTGE  480
KLDLGGEKAM ESARTLLSIG FEIKPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-27355427274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624879.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595831e-115WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A0V0I9Y10.0A0A0V0I9Y1_SOLCH; Putative WRKY transcription factor 32-like
STRINGSolyc07g005650.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA91892127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-103WRKY DNA-binding protein 32